| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
| Protein automated matches [190435] (8 species) not a true protein |
| Species Escherichia coli [TaxId:511145] [189613] (6 PDB entries) |
| Domain d3pvtb_: 3pvt B: [184017] automated match to d1otka_ complexed with 3hc, gol |
PDB Entry: 3pvt (more details), 2.03 Å
SCOPe Domain Sequences for d3pvtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pvtb_ a.25.1.2 (B:) automated matches {Escherichia coli [TaxId: 511145]}
snqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaela
gegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqla
aisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidials
eegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemq
Timeline for d3pvtb_: