Lineage for d3pvtb_ (3pvt B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1265471Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1265763Protein automated matches [190435] (8 species)
    not a true protein
  7. 1265773Species Escherichia coli [TaxId:511145] [189613] (6 PDB entries)
  8. 1265774Domain d3pvtb_: 3pvt B: [184017]
    automated match to d1otka_
    complexed with 3hc, gol

Details for d3pvtb_

PDB Entry: 3pvt (more details), 2.03 Å

PDB Description: The Phenylacetyl-CoA monooxygenase PaaAC subcomplex with 3-hydroxybutanoyl-CoA
PDB Compounds: (B:) Phenylacetic acid degradation protein paaC

SCOPe Domain Sequences for d3pvtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pvtb_ a.25.1.2 (B:) automated matches {Escherichia coli [TaxId: 511145]}
snqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaela
gegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqla
aisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidials
eegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemq

SCOPe Domain Coordinates for d3pvtb_:

Click to download the PDB-style file with coordinates for d3pvtb_.
(The format of our PDB-style files is described here.)

Timeline for d3pvtb_: