![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
![]() | Protein automated matches [190435] (12 species) not a true protein |
![]() | Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries) |
![]() | Domain d3pvtb1: 3pvt B:2-237 [184017] Other proteins in same PDB: d3pvtb2, d3pvtc2 automated match to d1otka_ complexed with 3hc, gol |
PDB Entry: 3pvt (more details), 2.03 Å
SCOPe Domain Sequences for d3pvtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pvtb1 a.25.1.2 (B:2-237) automated matches {Escherichia coli [TaxId: 511145]} nqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelag egdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaa isakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidialse egiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemq
Timeline for d3pvtb1: