SCOPe 2.01: Domain d3pvrc_: 3pvr C:

Lineage for d3pvrc_ (3pvr C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:511145] [189613] (6 PDB entries)

8. Domain d3pvrc_: 3pvr C: [184016]
   automated match to d1otka_
   complexed with byc, gol

Details for d3pvrc_

PDB Entry: 3pvr, 2.1 Å

PDB Description: The Phenylacetyl-CoA monooxygenase PaaAC subcomplex with benzoyl-CoA

PDB Compounds: (C:) Phenylacetic acid degradation protein paaC

SCOPe Domain Sequences for d3pvrc_:

Sequence; same for both SEQRES and ATOM records:

>d3pvrc_ a.25.1.2 (C:) automated matches {Escherichia coli [TaxId: 511145]}
snqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaela
gegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqla
aisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidials
eegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqylq
rvlpgqqw

Timeline for d3pvrc_:

• d3pvrc_ is new in SCOPe 2.01-stable
  
• d3pvrc_ appears in SCOPe 2.02
  
• d3pvrc_ appears in the current release, SCOPe 2.08, called d3pvrc1