| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
| Protein automated matches [190435] (12 species) not a true protein |
| Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries) |
| Domain d3pvrc1: 3pvr C:2-248 [184016] Other proteins in same PDB: d3pvrb2, d3pvrc2 automated match to d1otka_ complexed with byc, gol |
PDB Entry: 3pvr (more details), 2.1 Å
SCOPe Domain Sequences for d3pvrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pvrc1 a.25.1.2 (C:2-248) automated matches {Escherichia coli [TaxId: 511145]}
nqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelag
egdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaa
isakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidialse
egiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqylqr
vlpgqqw
Timeline for d3pvrc1: