Lineage for d3psnb_ (3psn B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679877Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1679878Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1680096Family d.159.1.7: YfcE-like [111233] (5 proteins)
  6. 1680114Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species)
  7. 1680122Species Mouse (Mus musculus) [TaxId:10090] [143936] (3 PDB entries)
    Uniprot Q9QZ88 1-182
  8. 1680128Domain d3psnb_: 3psn B: [183959]
    automated match to d1z2wa1
    complexed with mn

Details for d3psnb_

PDB Entry: 3psn (more details), 2.4 Å

PDB Description: Crystal structure of mouse VPS29 complexed with Mn2+
PDB Compounds: (B:) Vacuolar protein sorting-associated protein 29

SCOPe Domain Sequences for d3psnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3psnb_ d.159.1.7 (B:) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]}
mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
ks

SCOPe Domain Coordinates for d3psnb_:

Click to download the PDB-style file with coordinates for d3psnb_.
(The format of our PDB-style files is described here.)

Timeline for d3psnb_: