Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.7: YfcE-like [111233] (5 proteins) |
Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [143936] (6 PDB entries) Uniprot Q9QZ88 1-182 |
Domain d3psnb_: 3psn B: [183959] Other proteins in same PDB: d3psna2 automated match to d1z2wa1 complexed with mn |
PDB Entry: 3psn (more details), 2.4 Å
SCOPe Domain Sequences for d3psnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3psnb_ d.159.1.7 (B:) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk ks
Timeline for d3psnb_: