SCOPe 2.08: Domain d3psna1: 3psn A:1-182

Lineage for d3psna1 (3psn A:1-182)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.7: YfcE-like [111233] (5 proteins)

6. Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [143936] (6 PDB entries)
   Uniprot Q9QZ88 1-182

8. Domain d3psna1: 3psn A:1-182 [183958]
   Other proteins in same PDB: d3psna2
   automated match to d1z2wa1
   complexed with mn

Details for d3psna1

PDB Entry: 3psn, 2.4 Å

PDB Description: Crystal structure of mouse VPS29 complexed with Mn2+

PDB Compounds: (A:) Vacuolar protein sorting-associated protein 29

SCOPe Domain Sequences for d3psna1:

Sequence; same for both SEQRES and ATOM records:

>d3psna1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]}
mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
ks

Timeline for d3psna1:

• d3psna1 first appeared in SCOPe 2.01, called d3psna_
  
• d3psna1 appears in SCOPe 2.07