Lineage for d1z2wa1 (1z2w A:1-182)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplicationSuperfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) 
different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
Family d.159.1.7: YfcE-like [111233] (5 proteins) Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species) Species Mouse (Mus musculus) [TaxId:10090] [143936] (3 PDB entries)
Uniprot Q9QZ88 1-182
Domain d1z2wa1: 1z2w A:1-182 [124390]
complexed with gol, mn
Details for d1z2wa1
PDB Entry: 1z2w (more details), 2 Å
PDB Description: Crystal structure of mouse Vps29 complexed with Mn2+
PDB Compounds: (A:) vacuolar protein sorting 29SCOPe Domain Sequences for d1z2wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]}
mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
ks
SCOPe Domain Coordinates for d1z2wa1:
Click to download the PDB-style file with coordinates for d1z2wa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1z2wa1:
- d1z2wa1 first appeared in SCOP 1.73
- d1z2wa1 appears in SCOPe 2.03
- d1z2wa1 appears in SCOPe 2.05
- d1z2wa1 appears in the current release, SCOPe 2.08
View in 3D
