SCOPe 2.08: Domain d3pl7b_: 3pl7 B:

Lineage for d3pl7b_ (3pl7 B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (51 PDB entries)

8. Domain d3pl7b_: 3pl7 B: [183828]
   automated match to d1g5ja_

Details for d3pl7b_

PDB Entry: 3pl7, 2.61 Å

PDB Description: Crystal structure of Bcl-xL in complex with the BaxBH3 domain

PDB Compounds: (B:) Bcl-2-like protein 1

SCOPe Domain Sequences for d3pl7b_:

Sequence, based on SEQRES records:

>d3pl7b_ f.1.4.1 (B:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
snrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelryrr
afsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlv
sriaawmatylndhlepwiqenggwdtfvelyg

Sequence, based on observed residues (ATOM records):

>d3pl7b_ f.1.4.1 (B:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
snrelvvdflsyklsqkgyswsqfsdeseavkqalreagdefelryrrafsdltsqlhit
pgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatyln
dhlepwiqenggwdtfvelyg

Timeline for d3pl7b_:

• d3pl7b_ first appeared in SCOPe 2.01
  
• d3pl7b_ appears in SCOPe 2.07