Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (18 species) not a true protein |
Species Corynebacterium glutamicum [TaxId:1718] [189540] (1 PDB entry) |
Domain d3pl2b_: 3pl2 B: [183823] automated match to d1wyea1 complexed with cit |
PDB Entry: 3pl2 (more details), 1.89 Å
SCOPe Domain Sequences for d3pl2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pl2b_ c.72.1.0 (B:) automated matches {Corynebacterium glutamicum [TaxId: 1718]} sthevlaigrlgvdiyplqsgvgladvqsfgkylggsaanvsvaaarhghnsallsrvgn dpfgeyllaelerlgvdnqyvatdqtfktpvtfceifppddfplyfyrepkapdlniesa dvslddvreadilwftltgfseepsrgthreilttranrrhtifdldyrpmfwespeeat kqaewalqhstvavgnkeeceiavgeteperagrallergvelaivkqgpkgvmamtkde tvevppffvdvinglgagdafggalchgllsewplekvlrfantagalvasrlecstamp ttdeveasln
Timeline for d3pl2b_: