Lineage for d3pl2b_ (3pl2 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904668Species Corynebacterium glutamicum [TaxId:1718] [189540] (1 PDB entry)
  8. 2904670Domain d3pl2b_: 3pl2 B: [183823]
    automated match to d1wyea1
    complexed with cit

Details for d3pl2b_

PDB Entry: 3pl2 (more details), 1.89 Å

PDB Description: crystal structure of a 5-keto-2-deoxygluconokinase (ncgl0155, cgl0158) from corynebacterium glutamicum atcc 13032 kitasato at 1.89 a resolution
PDB Compounds: (B:) Sugar kinase, ribokinase family

SCOPe Domain Sequences for d3pl2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pl2b_ c.72.1.0 (B:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
sthevlaigrlgvdiyplqsgvgladvqsfgkylggsaanvsvaaarhghnsallsrvgn
dpfgeyllaelerlgvdnqyvatdqtfktpvtfceifppddfplyfyrepkapdlniesa
dvslddvreadilwftltgfseepsrgthreilttranrrhtifdldyrpmfwespeeat
kqaewalqhstvavgnkeeceiavgeteperagrallergvelaivkqgpkgvmamtkde
tvevppffvdvinglgagdafggalchgllsewplekvlrfantagalvasrlecstamp
ttdeveasln

SCOPe Domain Coordinates for d3pl2b_:

Click to download the PDB-style file with coordinates for d3pl2b_.
(The format of our PDB-style files is described here.)

Timeline for d3pl2b_: