Lineage for d3p4pc_ (3p4p C:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629948Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2630045Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 2630065Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 2630066Protein Fumarate reductase subunit FrdC [81370] (2 species)
  7. 2630067Species Escherichia coli [TaxId:536056] [224948] (2 PDB entries)
  8. 2630070Domain d3p4pc_: 3p4p C: [183505]
    Other proteins in same PDB: d3p4pb1, d3p4pb2, d3p4pd_, d3p4pn1, d3p4pn2, d3p4pp_
    automated match to d1kf6c_
    complexed with f3s, fad, fes, fum, sf4

Details for d3p4pc_

PDB Entry: 3p4p (more details), 2.8 Å

PDB Description: crystal structure of menaquinol:fumarate oxidoreductase in complex with fumarate
PDB Compounds: (C:) Fumarate reductase subunit C

SCOPe Domain Sequences for d3p4pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p4pc_ f.21.2.2 (C:) Fumarate reductase subunit FrdC {Escherichia coli [TaxId: 536056]}
ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
ivilfvalyw

SCOPe Domain Coordinates for d3p4pc_:

Click to download the PDB-style file with coordinates for d3p4pc_.
(The format of our PDB-style files is described here.)

Timeline for d3p4pc_: