SCOPe 2.01: Domain d3p4pc_: 3p4p C:

Lineage for d3p4pc_ (3p4p C:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (5 proteins)
   consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups

6. Protein automated matches [191206] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:536056] [189549] (1 PDB entry)

8. Domain d3p4pc_: 3p4p C: [183505]
   automated match to d1kf6c_
   complexed with f3s, fad, fes, fmr, sf4

Details for d3p4pc_

PDB Entry: 3p4p, 2.8 Å

PDB Description: crystal structure of menaquinol:fumarate oxidoreductase in complex with fumarate

PDB Compounds: (C:) Fumarate reductase subunit C

SCOPe Domain Sequences for d3p4pc_:

Sequence; same for both SEQRES and ATOM records:

>d3p4pc_ f.21.2.2 (C:) automated matches {Escherichia coli [TaxId: 536056]}
ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
ivilfvalyw

Timeline for d3p4pc_:

• d3p4pc_ is new in SCOPe 2.01-stable
  
• d3p4pc_ appears in SCOPe 2.02
  
• d3p4pc_ appears in the current release, SCOPe 2.08