![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
![]() | Protein Fumarate reductase [46550] (3 species) |
![]() | Species Escherichia coli [TaxId:362663] [224841] (1 PDB entry) |
![]() | Domain d3p4pb2: 3p4p B:106-243 [200192] Other proteins in same PDB: d3p4pb1, d3p4pc_, d3p4pd_, d3p4pn1, d3p4po_, d3p4pp_ automated match to d1kf6b1 complexed with f3s, fad, fes, fum, sf4 |
PDB Entry: 3p4p (more details), 2.8 Å
SCOPe Domain Sequences for d3p4pb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p4pb2 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 362663]} mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq qgkvesskdfliatlkpr
Timeline for d3p4pb2: