SCOPe 2.04: Domain d3p12b_: 3p12 B:

Lineage for d3p12b_ (3p12 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.133: RbsD-like [102545] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest

4. Superfamily c.133.1: RbsD-like [102546] (2 families)

5. Family c.133.1.0: automated matches [191558] (1 protein)
   not a true family

6. Protein automated matches [190962] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [189968] (2 PDB entries)

8. Domain d3p12b_: 3p12 B: [183434]
   automated match to d1ogca_
   complexed with gol

Details for d3p12b_

PDB Entry: 3p12, 2.35 Å

PDB Description: Crystal Structure of D-ribose Pyranase Sa240

PDB Compounds: (B:) D-ribose pyranase

SCOPe Domain Sequences for d3p12b_:

Sequence; same for both SEQRES and ATOM records:

>d3p12b_ c.133.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]}
vlnehiskaiatighfdlltindagmpipndhrridlavtknlprfidvlatvleemeiq
kiylaeeikehnptqlqqikqlisseieiifipheemksnlahplnkgnirtgettpysn
ialesnvtf

Timeline for d3p12b_:

• d3p12b_ first appeared in SCOPe 2.01
  
• d3p12b_ appears in SCOPe 2.03
  
• d3p12b_ appears in SCOPe 2.05
  
• d3p12b_ appears in the current release, SCOPe 2.08