Lineage for d3p12b_ (3p12 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923177Fold c.133: RbsD-like [102545] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest
  4. 2923178Superfamily c.133.1: RbsD-like [102546] (2 families) (S)
  5. 2923205Family c.133.1.0: automated matches [191558] (1 protein)
    not a true family
  6. 2923206Protein automated matches [190962] (7 species)
    not a true protein
  7. 2923259Species Staphylococcus aureus [TaxId:93061] [189968] (2 PDB entries)
  8. 2923261Domain d3p12b_: 3p12 B: [183434]
    automated match to d1ogca_
    complexed with gol

Details for d3p12b_

PDB Entry: 3p12 (more details), 2.35 Å

PDB Description: Crystal Structure of D-ribose Pyranase Sa240
PDB Compounds: (B:) D-ribose pyranase

SCOPe Domain Sequences for d3p12b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p12b_ c.133.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]}
vlnehiskaiatighfdlltindagmpipndhrridlavtknlprfidvlatvleemeiq
kiylaeeikehnptqlqqikqlisseieiifipheemksnlahplnkgnirtgettpysn
ialesnvtf

SCOPe Domain Coordinates for d3p12b_:

Click to download the PDB-style file with coordinates for d3p12b_.
(The format of our PDB-style files is described here.)

Timeline for d3p12b_: