Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.133: RbsD-like [102545] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest |
Superfamily c.133.1: RbsD-like [102546] (2 families) |
Family c.133.1.0: automated matches [191558] (1 protein) not a true family |
Protein automated matches [190962] (6 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [189968] (2 PDB entries) |
Domain d3p12b_: 3p12 B: [183434] automated match to d1ogca_ complexed with gol |
PDB Entry: 3p12 (more details), 2.35 Å
SCOPe Domain Sequences for d3p12b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p12b_ c.133.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]} vlnehiskaiatighfdlltindagmpipndhrridlavtknlprfidvlatvleemeiq kiylaeeikehnptqlqqikqlisseieiifipheemksnlahplnkgnirtgettpysn ialesnvtf
Timeline for d3p12b_: