Lineage for d1afva_ (1afv A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283076Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 283077Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 283078Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (4 proteins)
  6. 283084Protein HIV-1 capsid protein [47945] (1 species)
  7. 283085Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (14 PDB entries)
  8. 283105Domain d1afva_: 1afv A: [18324]
    Other proteins in same PDB: d1afvh1, d1afvh2, d1afvk1, d1afvk2, d1afvl1, d1afvl2, d1afvm1, d1afvm2

Details for d1afva_

PDB Entry: 1afv (more details), 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3

SCOP Domain Sequences for d1afva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afva_ a.73.1.1 (A:) HIV-1 capsid protein {Human immunodeficiency virus type 1}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysptsil

SCOP Domain Coordinates for d1afva_:

Click to download the PDB-style file with coordinates for d1afva_.
(The format of our PDB-style files is described here.)

Timeline for d1afva_: