| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries) |
| Domain d1afvm2: 1afv M:113-217 [21162] Other proteins in same PDB: d1afva_, d1afvb_, d1afvh1, d1afvh2, d1afvk1, d1afvk2, d1afvl1, d1afvm1 part of Fab 25.3 against HIV-1 capsid protein (p24) complexed with pb |
PDB Entry: 1afv (more details), 3.7 Å
SCOP Domain Sequences for d1afvm2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afvm2 b.1.1.2 (M:113-217) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d1afvm2: