Lineage for d1afvk2 (1afv K:121-220)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289192Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
  8. 289469Domain d1afvk2: 1afv K:121-220 [21163]
    Other proteins in same PDB: d1afva_, d1afvb_, d1afvh1, d1afvk1, d1afvl1, d1afvl2, d1afvm1, d1afvm2
    part of Fab 25.3 against HIV-1 capsid protein (p24)
    complexed with pb

Details for d1afvk2

PDB Entry: 1afv (more details), 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3

SCOP Domain Sequences for d1afvk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afvk2 b.1.1.2 (K:121-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpk

SCOP Domain Coordinates for d1afvk2:

Click to download the PDB-style file with coordinates for d1afvk2.
(The format of our PDB-style files is described here.)

Timeline for d1afvk2: