SCOP 1.65: Domain d1afvl2: 1afv L:113-217

Lineage for d1afvl2 (1afv L:113-217)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)

8. Domain d1afvl2: 1afv L:113-217 [21160]
   Other proteins in same PDB: d1afva_, d1afvb_, d1afvh1, d1afvh2, d1afvk1, d1afvk2, d1afvl1, d1afvm1

Details for d1afvl2

PDB Entry: 1afv, 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3

PDB Compounds: (L:)

SCOP Domain Sequences for d1afvl2:

Sequence; same for both SEQRES and ATOM records:

>d1afvl2 b.1.1.2 (L:113-217) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d1afvl2:

• d1afvl2 first appeared (with stable ids) in SCOP 1.55
  
• d1afvl2 appears in SCOP 1.63
  
• d1afvl2 appears in SCOP 1.67
  
• d1afvl2 appears in the current release, SCOPe 2.07