Class a: All alpha proteins [46456] (290 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.2: Ypt/Rab-GAP domain of gyp1p [47923] (1 family) |
Family a.69.2.1: Ypt/Rab-GAP domain of gyp1p [47924] (2 proteins) duplication: contains two similar domains of this fold |
Protein Ypt/Rab-GAP domain of gyp1p, N-terminal domain [418896] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419296] (2 PDB entries) |
Domain d1fkma1: 1fkm A:249-442 [18315] Other proteins in same PDB: d1fkma2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1fkm (more details), 1.9 Å
SCOPe Domain Sequences for d1fkma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fkma1 a.69.2.1 (A:249-442) Ypt/Rab-GAP domain of gyp1p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nsiiqriskfdnilkdktiinqqdlrqiswngipkihrpvvwklligylpvntkrqegfl qrkrkeyrdslkhtfsdqhsrdiptwhqieidiprtnphiplyqfksvqnslqrilylwa irhpasgyvqgindlvtpffetflteylppsqiddveikdpstymvdeqitdleadtfwc ltklleqitdnyih
Timeline for d1fkma1: