Lineage for d1fkma1 (1fkm A:249-442)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717697Superfamily a.69.2: Ypt/Rab-GAP domain of gyp1p [47923] (1 family) (S)
  5. 2717698Family a.69.2.1: Ypt/Rab-GAP domain of gyp1p [47924] (2 proteins)
    duplication: contains two similar domains of this fold
  6. 2717703Protein Ypt/Rab-GAP domain of gyp1p, N-terminal domain [418896] (1 species)
  7. 2717704Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419296] (2 PDB entries)
  8. 2717706Domain d1fkma1: 1fkm A:249-442 [18315]
    Other proteins in same PDB: d1fkma2
    has additional insertions and/or extensions that are not grouped together

Details for d1fkma1

PDB Entry: 1fkm (more details), 1.9 Å

PDB Description: crystal structure of the ypt/rab-gap domain of gyp1p
PDB Compounds: (A:) protein (gyp1p)

SCOPe Domain Sequences for d1fkma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkma1 a.69.2.1 (A:249-442) Ypt/Rab-GAP domain of gyp1p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nsiiqriskfdnilkdktiinqqdlrqiswngipkihrpvvwklligylpvntkrqegfl
qrkrkeyrdslkhtfsdqhsrdiptwhqieidiprtnphiplyqfksvqnslqrilylwa
irhpasgyvqgindlvtpffetflteylppsqiddveikdpstymvdeqitdleadtfwc
ltklleqitdnyih

SCOPe Domain Coordinates for d1fkma1:

Click to download the PDB-style file with coordinates for d1fkma1.
(The format of our PDB-style files is described here.)

Timeline for d1fkma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fkma2