Lineage for d1fkma1 (1fkm A:249-442)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4749Fold a.69: Left-handed superhelix [47916] (2 superfamilies)
  4. 4802Superfamily a.69.2: Ypt/Rab-GAP domain of gyp1p [47923] (1 family) (S)
  5. 4803Family a.69.2.1: Ypt/Rab-GAP domain of gyp1p [47924] (1 protein)
  6. 4804Protein Ypt/Rab-GAP domain of gyp1p [47925] (1 species)
  7. 4805Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47926] (1 PDB entry)
  8. 4806Domain d1fkma1: 1fkm A:249-442 [18315]

Details for d1fkma1

PDB Entry: 1fkm (more details), 1.9 Å

PDB Description: crystal structure of the ypt/rab-gap domain of gyp1p

SCOP Domain Sequences for d1fkma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkma1 a.69.2.1 (A:249-442) Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccharomyces cerevisiae)}
nsiiqriskfdnilkdktiinqqdlrqiswngipkihrpvvwklligylpvntkrqegfl
qrkrkeyrdslkhtfsdqhsrdiptwhqieidiprtnphiplyqfksvqnslqrilylwa
irhpasgyvqgindlvtpffetflteylppsqiddveikdpstymvdeqitdleadtfwc
ltklleqitdnyih

SCOP Domain Coordinates for d1fkma1:

Click to download the PDB-style file with coordinates for d1fkma1.
(The format of our PDB-style files is described here.)

Timeline for d1fkma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fkma2