SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1fkma2 (1fkm A:443-630)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000218Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2000518Superfamily a.69.2: Ypt/Rab-GAP domain of gyp1p [47923] (1 family) (S)
  5. 2000519Family a.69.2.1: Ypt/Rab-GAP domain of gyp1p [47924] (1 protein)
    duplication: contains two similar domains of this fold
  6. 2000520Protein Ypt/Rab-GAP domain of gyp1p [47925] (1 species)
  7. 2000521Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47926] (2 PDB entries)
  8. 2000523Domain d1fkma2: 1fkm A:443-630 [18316]

Details for d1fkma2

PDB Entry: 1fkm (more details), 1.9 Å

PDB Description: crystal structure of the ypt/rab-gap domain of gyp1p
PDB Compounds: (A:) protein (gyp1p)

SCOPe Domain Sequences for d1fkma2:

Sequence, based on SEQRES records: (download)

>d1fkma2 a.69.2.1 (A:443-630) Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqpgilrqvknlsqlvkridadlynhfqnehvefiqfafrwmncllmrefqmgtvirmwd
tylsetsqevtssysmssndikppvtpteprvasfvtptkdfqspttalsnmtpnnaved
sgkmrqsslnefhvfvcaaflikwsdqlmemdfqetitflqnpptkdwtetdiemllsea
fiwqslyk

Sequence, based on observed residues (ATOM records): (download)

>d1fkma2 a.69.2.1 (A:443-630) Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqpgilrqvknlsqlvkridadlynhfqnehvefiqfafrwmncllmrefqmgtvirmwd
tylsetsslnefhvfvcaaflikwsdqlmemdfqetitflqnpptkdwtetdiemllsea
fiwqslyk

SCOPe Domain Coordinates for d1fkma2:

Click to download the PDB-style file with coordinates for d1fkma2.
(The format of our PDB-style files is described here.)

Timeline for d1fkma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fkma1