SCOPe 2.08: Domain d1fkma2: 1fkm A:443-630

Lineage for d1fkma2 (1fkm A:443-630)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.2: Ypt/Rab-GAP domain of gyp1p [47923] (1 family)

5. Family a.69.2.1: Ypt/Rab-GAP domain of gyp1p [47924] (2 proteins)
   duplication: contains two similar domains of this fold

6. Protein Ypt/Rab-GAP domain of gyp1p, C-terminal domain [418897] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419297] (2 PDB entries)

8. Domain d1fkma2: 1fkm A:443-630 [18316]
   Other proteins in same PDB: d1fkma1

Details for d1fkma2

PDB Entry: 1fkm, 1.9 Å

PDB Description: crystal structure of the ypt/rab-gap domain of gyp1p

PDB Compounds: (A:) protein (gyp1p)

SCOPe Domain Sequences for d1fkma2:

Sequence, based on SEQRES records:

>d1fkma2 a.69.2.1 (A:443-630) Ypt/Rab-GAP domain of gyp1p, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqpgilrqvknlsqlvkridadlynhfqnehvefiqfafrwmncllmrefqmgtvirmwd
tylsetsqevtssysmssndikppvtpteprvasfvtptkdfqspttalsnmtpnnaved
sgkmrqsslnefhvfvcaaflikwsdqlmemdfqetitflqnpptkdwtetdiemllsea
fiwqslyk

Sequence, based on observed residues (ATOM records):

>d1fkma2 a.69.2.1 (A:443-630) Ypt/Rab-GAP domain of gyp1p, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqpgilrqvknlsqlvkridadlynhfqnehvefiqfafrwmncllmrefqmgtvirmwd
tylsetsslnefhvfvcaaflikwsdqlmemdfqetitflqnpptkdwtetdiemllsea
fiwqslyk

Timeline for d1fkma2:

• d1fkma2 first appeared (with stable ids) in SCOP 1.55
  
• d1fkma2 appears in SCOPe 2.07