Lineage for d3oifa_ (3oif A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 975436Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 975885Protein Enoyl-ACP reductase [51791] (10 species)
  7. 975888Species Bacillus subtilis [TaxId:1423] [189591] (2 PDB entries)
  8. 975890Domain d3oifa_: 3oif A: [183048]
    automated match to d1lxca_
    complexed with nad, tcl

Details for d3oifa_

PDB Entry: 3oif (more details), 2.6 Å

PDB Description: Crystal Structure of Enoyl-ACP Reductases I (FabI) from B. subtilis (complex with NAD and TCL)
PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d3oifa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oifa_ c.2.1.2 (A:) Enoyl-ACP reductase {Bacillus subtilis [TaxId: 1423]}
mnfslegrnivvmgvankrsiawgiarslheagarliftyagerleksvhelagtldrnd
siilpcdvtndaeietcfasikeqvgvihgiahciafankeelvgeylntnrdgfllahn
issysltavvkaarpmmteggsivtltylggelvmpnynvmgvakasldasvkylaadlg
kenirvnsisagpirtlsakgisdfnsilkdieeraplrrtttpeevgdtaaflfsdmsr
gitgenlhvdsgfhitar

SCOPe Domain Coordinates for d3oifa_:

Click to download the PDB-style file with coordinates for d3oifa_.
(The format of our PDB-style files is described here.)

Timeline for d3oifa_: