| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
| Protein Enoyl-ACP reductase [51791] (11 species) |
| Species Bacillus subtilis [TaxId:1423] [189591] (2 PDB entries) |
| Domain d3oifa_: 3oif A: [183048] automated match to d1lxca_ complexed with nad, tcl |
PDB Entry: 3oif (more details), 2.6 Å
SCOPe Domain Sequences for d3oifa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oifa_ c.2.1.2 (A:) Enoyl-ACP reductase {Bacillus subtilis [TaxId: 1423]}
mnfslegrnivvmgvankrsiawgiarslheagarliftyagerleksvhelagtldrnd
siilpcdvtndaeietcfasikeqvgvihgiahciafankeelvgeylntnrdgfllahn
issysltavvkaarpmmteggsivtltylggelvmpnynvmgvakasldasvkylaadlg
kenirvnsisagpirtlsakgisdfnsilkdieeraplrrtttpeevgdtaaflfsdmsr
gitgenlhvdsgfhitar
Timeline for d3oifa_: