Lineage for d3ohpb_ (3ohp B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1175015Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1175016Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1175017Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 1175316Protein automated matches [190074] (7 species)
    not a true protein
  7. 1175339Species Vibrio cholerae [TaxId:666] [189453] (1 PDB entry)
  8. 1175341Domain d3ohpb_: 3ohp B: [183032]
    automated match to d1g9sa_

Details for d3ohpb_

PDB Entry: 3ohp (more details), 2.04 Å

PDB Description: crystal structure of hgprt from vibrio cholerae
PDB Compounds: (B:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d3ohpb_:

Sequence, based on SEQRES records: (download)

>d3ohpb_ c.61.1.1 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
khtvevmiseqevaqrirelgqqitehyqgssdlvlvgllrgsfvfmadlarqihlthqv
dfmtassygnsmqssrdvrilkdldddikgkdvllvediidtgntlnkvkeilalrepks
irictlldkptrrevdvevnwvgfeipdefvvgvgidyaqkyrhlpyigkvvpla

Sequence, based on observed residues (ATOM records): (download)

>d3ohpb_ c.61.1.1 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
khtvevmiseqevaqrirelgqqitehyqgssdlvlvgllrgsfvfmadlarqihlthqv
dfmtassrdvrilkdldddikgkdvllvediidtgntlnkvkeilalrepksirictlld
kptrrevdvevnwvgfeipdefvvgvgidyaqkyrhlpyigkvvpla

SCOPe Domain Coordinates for d3ohpb_:

Click to download the PDB-style file with coordinates for d3ohpb_.
(The format of our PDB-style files is described here.)

Timeline for d3ohpb_: