SCOPe 2.01: Domain d3ohpb_: 3ohp B:

Lineage for d3ohpb_ (3ohp B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein automated matches [190074] (7 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [189453] (1 PDB entry)

8. Domain d3ohpb_: 3ohp B: [183032]
   automated match to d1g9sa_

Details for d3ohpb_

PDB Entry: 3ohp, 2.04 Å

PDB Description: crystal structure of hgprt from vibrio cholerae

PDB Compounds: (B:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d3ohpb_:

Sequence, based on SEQRES records:

>d3ohpb_ c.61.1.1 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
khtvevmiseqevaqrirelgqqitehyqgssdlvlvgllrgsfvfmadlarqihlthqv
dfmtassygnsmqssrdvrilkdldddikgkdvllvediidtgntlnkvkeilalrepks
irictlldkptrrevdvevnwvgfeipdefvvgvgidyaqkyrhlpyigkvvpla

Sequence, based on observed residues (ATOM records):

>d3ohpb_ c.61.1.1 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
khtvevmiseqevaqrirelgqqitehyqgssdlvlvgllrgsfvfmadlarqihlthqv
dfmtassrdvrilkdldddikgkdvllvediidtgntlnkvkeilalrepksirictlld
kptrrevdvevnwvgfeipdefvvgvgidyaqkyrhlpyigkvvpla

Timeline for d3ohpb_:

• d3ohpb_ is new in SCOPe 2.01-stable
  
• d3ohpb_ appears in SCOPe 2.02
  
• d3ohpb_ appears in the current release, SCOPe 2.08