Lineage for d3o79b_ (3o79 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175107Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2175108Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2175109Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 2175110Protein Prion protein domain [54100] (14 species)
  7. 2175156Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [189522] (1 PDB entry)
  8. 2175158Domain d3o79b_: 3o79 B: [182854]
    automated match to d1y2sa_
    complexed with cl, gol, na

Details for d3o79b_

PDB Entry: 3o79 (more details), 1.6 Å

PDB Description: Crystal Structure of Wild-type Rabbit PrP 126-230
PDB Compounds: (B:) Rabbit PrP

SCOPe Domain Sequences for d3o79b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o79b_ d.6.1.1 (B:) Prion protein domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnsfvhdcvnitvk
qhtvttttkgenftetdikimervveqmcitqyqqesqaayqraa

SCOPe Domain Coordinates for d3o79b_:

Click to download the PDB-style file with coordinates for d3o79b_.
(The format of our PDB-style files is described here.)

Timeline for d3o79b_: