SCOPe 2.01: Domain d3o79b_: 3o79 B:

Lineage for d3o79b_ (3o79 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein Prion protein domain [54100] (13 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [189522] (1 PDB entry)

8. Domain d3o79b_: 3o79 B: [182854]
   automated match to d1y2sa_
   complexed with cl, gol, na

Details for d3o79b_

PDB Entry: 3o79, 1.6 Å

PDB Description: Crystal Structure of Wild-type Rabbit PrP 126-230

PDB Compounds: (B:) Rabbit PrP

SCOPe Domain Sequences for d3o79b_:

Sequence; same for both SEQRES and ATOM records:

>d3o79b_ d.6.1.1 (B:) Prion protein domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnsfvhdcvnitvk
qhtvttttkgenftetdikimervveqmcitqyqqesqaayqraa

Timeline for d3o79b_:

• d3o79b_ is new in SCOPe 2.01-stable
  
• d3o79b_ appears in SCOPe 2.02
  
• d3o79b_ appears in the current release, SCOPe 2.08