Lineage for d3o79a_ (3o79 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016146Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1016147Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1016148Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1016149Protein Prion protein domain [54100] (13 species)
  7. 1016192Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [189522] (1 PDB entry)
  8. 1016193Domain d3o79a_: 3o79 A: [182853]
    automated match to d1y2sa_
    complexed with cl, gol, na

Details for d3o79a_

PDB Entry: 3o79 (more details), 1.6 Å

PDB Description: Crystal Structure of Wild-type Rabbit PrP 126-230
PDB Compounds: (A:) Rabbit PrP

SCOPe Domain Sequences for d3o79a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o79a_ d.6.1.1 (A:) Prion protein domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnsfvhdcvnitvk
qhtvttttkgenftetdikimervveqmcitqyqqes

SCOPe Domain Coordinates for d3o79a_:

Click to download the PDB-style file with coordinates for d3o79a_.
(The format of our PDB-style files is described here.)

Timeline for d3o79a_: