Lineage for d1y2sa_ (1y2s A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890617Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1890618Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1890619Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1890620Protein Prion protein domain [54100] (14 species)
  7. 1890671Species Sheep (Ovis aries) [TaxId:9940] [102729] (6 PDB entries)
    Uniprot P23907 124-234 ! Uniprot P23907 122-234 ! Uniprot P23907 127-228
  8. 1890674Domain d1y2sa_: 1y2s A: [116406]

Details for d1y2sa_

PDB Entry: 1y2s (more details)

PDB Description: ovine prion protein variant r168
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d1y2sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y2sa_ d.6.1.1 (A:) Prion protein domain {Sheep (Ovis aries) [TaxId: 9940]}
gsvvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdrysnqnnfvhd
cvnitvkqhtvttttkgenftetdikimervveqmcitqyqresqayyqrgas

SCOPe Domain Coordinates for d1y2sa_:

Click to download the PDB-style file with coordinates for d1y2sa_.
(The format of our PDB-style files is described here.)

Timeline for d1y2sa_: