Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (6 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (20 PDB entries) |
Domain d3nzxg_: 3nzx G: [182700] Other proteins in same PDB: d3nzxa_, d3nzxe_, d3nzxi_, d3nzxj_, d3nzxo_, d3nzxs_, d3nzxw_, d3nzxx_ automated match to d1g65g_ |
PDB Entry: 3nzx (more details), 2.7 Å
SCOPe Domain Sequences for d3nzxg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nzxg_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia eqd
Timeline for d3nzxg_: