Lineage for d3nzx2_ (3nzx 2:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045650Protein automated matches [190144] (6 species)
    not a true protein
  7. 1045671Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (20 PDB entries)
  8. 1045710Domain d3nzx2_: 3nzx 2: [182695]
    Other proteins in same PDB: d3nzxa_, d3nzxe_, d3nzxi_, d3nzxj_, d3nzxo_, d3nzxs_, d3nzxw_, d3nzxx_
    automated match to d1ryph_

Details for d3nzx2_

PDB Entry: 3nzx (more details), 2.7 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with ligand 2c
PDB Compounds: (2:) Proteasome component PRE3

SCOPe Domain Sequences for d3nzx2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzx2_ d.153.1.4 (2:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

SCOPe Domain Coordinates for d3nzx2_:

Click to download the PDB-style file with coordinates for d3nzx2_.
(The format of our PDB-style files is described here.)

Timeline for d3nzx2_: