SCOPe 2.07: Domain d3ngfb1: 3ngf B:1-258

Lineage for d3ngfb1 (3ngf B:1-258)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (8 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.0: automated matches [191634] (1 protein)
   not a true family

6. Protein automated matches [191168] (5 species)
   not a true protein

7. Species Brucella melitensis [TaxId:359391] [189392] (1 PDB entry)

8. Domain d3ngfb1: 3ngf B:1-258 [182261]
   Other proteins in same PDB: d3ngfb2
   automated match to d1k77a_
   complexed with gol, mn

Details for d3ngfb1

PDB Entry: 3ngf, 1.8 Å

PDB Description: Crystal structure of AP endonuclease, family 2 from Brucella melitensis

PDB Compounds: (B:) AP endonuclease, family 2

SCOPe Domain Sequences for d3ngfb1:

Sequence; same for both SEQRES and ATOM records:

>d3ngfb1 c.1.15.0 (B:1-258) automated matches {Brucella melitensis [TaxId: 359391]}
mprfaanlstmfnevpflerfrlaaeagfggveflfpydfdadviarelkqhnltqvlfn
mppgdwaagergmaaisgreqefrdnvdialhyalaldcrtlhamsgitegldrkaceet
fienfryaadklaphgitvlveplntrnmpgyfivhqleavglvkrvnrpnvavqldlyh
aqimdgdltrliekmngafshvqiasvpdrhepdegelnypylfsvlesvgyrgwvgcey
nprgktesglawfapyrd

Timeline for d3ngfb1:

• d3ngfb1 first appeared in SCOPe 2.01, called d3ngfb_
  
• d3ngfb1 appears in SCOPe 2.06
  
• d3ngfb1 appears in the current release, SCOPe 2.08