Lineage for d3nfed_ (3nfe D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687006Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46513] (7 PDB entries)
  8. 2687012Domain d3nfed_: 3nfe D: [182231]
    Other proteins in same PDB: d3nfea_, d3nfec_
    automated match to d1t1nb_
    complexed with hem

Details for d3nfed_

PDB Entry: 3nfe (more details), 2.01 Å

PDB Description: The crystal structure of hemoglobin I from trematomus newnesi in deoxygenated state
PDB Compounds: (D:) Hemoglobin subunit beta-1/2

SCOPe Domain Sequences for d3nfed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nfed_ a.1.1.2 (D:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflaavvsalgkqyh

SCOPe Domain Coordinates for d3nfed_:

Click to download the PDB-style file with coordinates for d3nfed_.
(The format of our PDB-style files is described here.)

Timeline for d3nfed_: