![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46513] (7 PDB entries) |
![]() | Domain d3nfeb_: 3nfe B: [182229] Other proteins in same PDB: d3nfea_, d3nfec_ automated match to d1t1nb_ complexed with hem |
PDB Entry: 3nfe (more details), 2.01 Å
SCOPe Domain Sequences for d3nfeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nfeb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh aftaetqgafqkflaavvsalgkqyh
Timeline for d3nfeb_: