Lineage for d3neyd1 (3ney D:282-458)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872281Domain d3neyd1: 3ney D:282-458 [182209]
    Other proteins in same PDB: d3neya2, d3neyb2, d3neyc2, d3neyd2, d3neye2, d3neyf2
    automated match to d1kgda_
    complexed with so4, unx

Details for d3neyd1

PDB Entry: 3ney (more details), 2.26 Å

PDB Description: crystal structure of the kinase domain of mpp1/p55
PDB Compounds: (D:) 55 kDa erythrocyte membrane protein

SCOPe Domain Sequences for d3neyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3neyd1 c.37.1.0 (D:282-458) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rktlvligasgvgrshiknallsqnpekfvypvpyttrpprkseedgkeyhfisteemtr
nisaneflefgsyqgnmfgtkfetvhqihkqnkiaildiepqtlkivrtaelspfivfia
ptdqgtqtealqqlqkdseairsqyahyfdlslvnngvdetlkklqeafdqacsspq

SCOPe Domain Coordinates for d3neyd1:

Click to download the PDB-style file with coordinates for d3neyd1.
(The format of our PDB-style files is described here.)

Timeline for d3neyd1: