SCOPe 2.07: Domain d3neyd1: 3ney D:282-458

Lineage for d3neyd1 (3ney D:282-458)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)

8. Domain d3neyd1: 3ney D:282-458 [182209]
   Other proteins in same PDB: d3neya2, d3neyb2, d3neyc2, d3neyd2, d3neye2, d3neyf2
   automated match to d1kgda_
   complexed with so4, unx

Details for d3neyd1

PDB Entry: 3ney, 2.26 Å

PDB Description: crystal structure of the kinase domain of mpp1/p55

PDB Compounds: (D:) 55 kDa erythrocyte membrane protein

SCOPe Domain Sequences for d3neyd1:

Sequence; same for both SEQRES and ATOM records:

>d3neyd1 c.37.1.0 (D:282-458) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rktlvligasgvgrshiknallsqnpekfvypvpyttrpprkseedgkeyhfisteemtr
nisaneflefgsyqgnmfgtkfetvhqihkqnkiaildiepqtlkivrtaelspfivfia
ptdqgtqtealqqlqkdseairsqyahyfdlslvnngvdetlkklqeafdqacsspq

Timeline for d3neyd1:

• d3neyd1 first appeared in SCOPe 2.01, called d3neyd_
  
• d3neyd1 appears in SCOPe 2.06
  
• d3neyd1 appears in the current release, SCOPe 2.08