PDB entry 3ney

View 3ney on RCSB PDB site
Description: Crystal structure of the kinase domain of MPP1/p55
Class: membrane protein
Keywords: structural genomics consortium, sgc, 55 kDa erythrocyte membrane protein, MEMBRANE PROTEIN
Deposited on 2010-06-09, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 55 kDa erythrocyte membrane protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MPP1, DXS552E, EMP55
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00013 (18-End)
      • expression tag (15-17)
    Domains in SCOPe 2.07: d3neya1, d3neya2
  • Chain 'B':
    Compound: 55 kDa erythrocyte membrane protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MPP1, DXS552E, EMP55
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00013 (18-End)
      • expression tag (15-17)
    Domains in SCOPe 2.07: d3neyb1, d3neyb2
  • Chain 'C':
    Compound: 55 kDa erythrocyte membrane protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MPP1, DXS552E, EMP55
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00013 (18-End)
      • expression tag (15-17)
    Domains in SCOPe 2.07: d3neyc1, d3neyc2
  • Chain 'D':
    Compound: 55 kDa erythrocyte membrane protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MPP1, DXS552E, EMP55
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00013 (18-End)
      • expression tag (15-17)
    Domains in SCOPe 2.07: d3neyd1, d3neyd2
  • Chain 'E':
    Compound: 55 kDa erythrocyte membrane protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MPP1, DXS552E, EMP55
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00013 (18-End)
      • expression tag (15-17)
    Domains in SCOPe 2.07: d3neye1, d3neye2
  • Chain 'F':
    Compound: 55 kDa erythrocyte membrane protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MPP1, DXS552E, EMP55
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00013 (18-End)
      • expression tag (17)
    Domains in SCOPe 2.07: d3neyf1, d3neyf2
  • Heterogens: SO4, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3neyA (A:)
    mhhhhhhssgrenlyfqgrktlvligasgvgrshiknallsqnpekfvypvpyttrpprk
    seedgkeyhfisteemtrnisaneflefgsyqgnmfgtkfetvhqihkqnkiaildiepq
    tlkivrtaelspfivfiaptdqgtqtealqqlqkdseairsqyahyfdlslvnngvdetl
    kklqeafdqacsspqwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3neyA (A:)
    fqgrktlvligasgvgrshiknallsqnpekfvypvpyttrpprkseedgkeyhfistee
    mtrnisaneflefgsyqgnmfgtkfetvhqihkqnkiaildiepqtlkivrtaelspfiv
    fiaptdqgtqtealqqlqkdseairsqyahyfdlslvnngvdetlkklqeafdqacsspq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3neyB (B:)
    mhhhhhhssgrenlyfqgrktlvligasgvgrshiknallsqnpekfvypvpyttrpprk
    seedgkeyhfisteemtrnisaneflefgsyqgnmfgtkfetvhqihkqnkiaildiepq
    tlkivrtaelspfivfiaptdqgtqtealqqlqkdseairsqyahyfdlslvnngvdetl
    kklqeafdqacsspqwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3neyB (B:)
    fqgrktlvligasgvgrshiknallsqnpekfvypvpyttrpprkseedgkeyhfistee
    mtrnisaneflefgsyqgnmfgtkfetvhqihkqnkiaildiepqtlkivrtaelspfiv
    fiaptdqgtqtealqqlqkdseairsqyahyfdlslvnngvdetlkklqeafdqacsspq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3neyC (C:)
    mhhhhhhssgrenlyfqgrktlvligasgvgrshiknallsqnpekfvypvpyttrpprk
    seedgkeyhfisteemtrnisaneflefgsyqgnmfgtkfetvhqihkqnkiaildiepq
    tlkivrtaelspfivfiaptdqgtqtealqqlqkdseairsqyahyfdlslvnngvdetl
    kklqeafdqacsspqwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3neyC (C:)
    fqgrktlvligasgvgrshiknallsqnpekfvypvpyttrpprkseedgkeyhfistee
    mtrnisaneflefgsyqgnmfgtkfetvhqihkqnkiaildiepqtlkivrtaelspfiv
    fiaptdqgtqtealqqlqkdseairsqyahyfdlslvnngvdetlkklqeafdqacsspq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3neyD (D:)
    mhhhhhhssgrenlyfqgrktlvligasgvgrshiknallsqnpekfvypvpyttrpprk
    seedgkeyhfisteemtrnisaneflefgsyqgnmfgtkfetvhqihkqnkiaildiepq
    tlkivrtaelspfivfiaptdqgtqtealqqlqkdseairsqyahyfdlslvnngvdetl
    kklqeafdqacsspqwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3neyD (D:)
    fqgrktlvligasgvgrshiknallsqnpekfvypvpyttrpprkseedgkeyhfistee
    mtrnisaneflefgsyqgnmfgtkfetvhqihkqnkiaildiepqtlkivrtaelspfiv
    fiaptdqgtqtealqqlqkdseairsqyahyfdlslvnngvdetlkklqeafdqacsspq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3neyE (E:)
    mhhhhhhssgrenlyfqgrktlvligasgvgrshiknallsqnpekfvypvpyttrpprk
    seedgkeyhfisteemtrnisaneflefgsyqgnmfgtkfetvhqihkqnkiaildiepq
    tlkivrtaelspfivfiaptdqgtqtealqqlqkdseairsqyahyfdlslvnngvdetl
    kklqeafdqacsspqwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3neyE (E:)
    fqgrktlvligasgvgrshiknallsqnpekfvypvpyttrpprkseedgkeyhfistee
    mtrnisaneflefgsyqgnmfgtkfetvhqihkqnkiaildiepqtlkivrtaelspfiv
    fiaptdqgtqtealqqlqkdseairsqyahyfdlslvnngvdetlkklqeafdqacsspq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3neyF (F:)
    mhhhhhhssgrenlyfqgrktlvligasgvgrshiknallsqnpekfvypvpyttrpprk
    seedgkeyhfisteemtrnisaneflefgsyqgnmfgtkfetvhqihkqnkiaildiepq
    tlkivrtaelspfivfiaptdqgtqtealqqlqkdseairsqyahyfdlslvnngvdetl
    kklqeafdqacsspqwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3neyF (F:)
    grktlvligasgvgrshiknallsqnpekfvypvpyttrppredgkeyhfisteemtrni
    saneflefgsyqgnmfgtkfetvhqihkqnkiaildiepqtlkivrtaelspfivfiapt
    dqgtqtealqqlqkdseairsqyahyfdlslvnngvdetlkklqeafdqacsspq