| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
| Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
| Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries) |
| Domain d1fqjd1: 1fqj D:61-181 [18216] Other proteins in same PDB: d1fqja2, d1fqjb_, d1fqjc_, d1fqjd2, d1fqje_ species chimera complexed with alf, gdp, mg |
PDB Entry: 1fqj (more details), 2.02 Å
SCOPe Domain Sequences for d1fqjd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqjd1 a.66.1.1 (D:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmpkems
diiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvkttgi
i
Timeline for d1fqjd1: