Lineage for d1fqjb_ (1fqj B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719790Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2719791Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2719792Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 2719835Protein RGS9, RGS domain [48101] (1 species)
  7. 2719836Species Cow (Bos taurus) [TaxId:9913] [48102] (3 PDB entries)
  8. 2719838Domain d1fqjb_: 1fqj B: [18543]
    Other proteins in same PDB: d1fqja1, d1fqja2, d1fqjc_, d1fqjd1, d1fqjd2
    complexed with alf, gdp, mg

Details for d1fqjb_

PDB Entry: 1fqj (more details), 2.02 Å

PDB Description: crystal structure of the heterotrimeric complex of the rgs domain of rgs9, the gamma subunit of phosphodiesterase and the gt/i1 chimera alpha subunit [(rgs9)-(pdegamma)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]
PDB Compounds: (B:) regulator of g-protein signaling 9

SCOPe Domain Sequences for d1fqjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqjb_ a.91.1.1 (B:) RGS9, RGS domain {Cow (Bos taurus) [TaxId: 9913]}
diptkmrverwafnfselirdpkgrqsfqhflrkefsgenlgfweacedlkygdqskvke
kaeeiyklflapgarrwinidgktmditvkglkhphryvldaaqthiymlmkkdsyaryl
kspiykemlakai

SCOPe Domain Coordinates for d1fqjb_:

Click to download the PDB-style file with coordinates for d1fqjb_.
(The format of our PDB-style files is described here.)

Timeline for d1fqjb_: