SCOPe 2.08: Domain d1fqjc_: 1fqj C:

Lineage for d1fqjc_ (1fqj C:)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.51: cAMP and cGMP phosphodiesterase (PDE) fragments [58650] (1 superfamily)

4. Superfamily j.51.1: cAMP and cGMP phosphodiesterase (PDE) fragments [58651] (1 family)

5. Family j.51.1.1: cAMP and cGMP phosphodiesterase (PDE) fragments [58652] (2 proteins)
   not a true family

6. Protein cGMP-PDE gamma [58655] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [58656] (1 PDB entry)

8. Domain d1fqjc_: 1fqj C: [46332]
   Other proteins in same PDB: d1fqja1, d1fqja2, d1fqjb_, d1fqjd1, d1fqjd2, d1fqje_
   residues 46-87 bound to Gi1 alpha
   complexed with alf, gdp, mg

Details for d1fqjc_

PDB Entry: 1fqj, 2.02 Å

PDB Description: crystal structure of the heterotrimeric complex of the rgs domain of rgs9, the gamma subunit of phosphodiesterase and the gt/i1 chimera alpha subunit [(rgs9)-(pdegamma)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]

PDB Compounds: (C:) Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma

SCOPe Domain Sequences for d1fqjc_:

Sequence; same for both SEQRES and ATOM records:

>d1fqjc_ j.51.1.1 (C:) cGMP-PDE gamma {Cow (Bos taurus) [TaxId: 9913]}
fgddipgmeglgtditvicpweafnhlelhelaqygii

Timeline for d1fqjc_:

• d1fqjc_ first appeared (with stable ids) in SCOP 1.55
  
• d1fqjc_ appears in SCOPe 2.07