Lineage for d1azsc1 (1azs C:86-201)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4652Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
  4. 4653Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
  5. 4654Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 4655Protein Transducin (alpha subunit), insertion domain [47897] (2 species)
  7. 4656Species Cow (Bos taurus) [TaxId:9913] [47898] (11 PDB entries)
  8. 4664Domain d1azsc1: 1azs C:86-201 [18203]
    Other proteins in same PDB: d1azsa_, d1azsb_, d1azsc2

Details for d1azsc1

PDB Entry: 1azs (more details), 2.3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase

SCOP Domain Sequences for d1azsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azsc1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus)}
gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe
fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

SCOP Domain Coordinates for d1azsc1:

Click to download the PDB-style file with coordinates for d1azsc1.
(The format of our PDB-style files is described here.)

Timeline for d1azsc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1azsc2