Class a: All alpha proteins [46456] (290 folds) |
Fold a.65: Annexin [47873] (1 superfamily) 5 helices; folded leaf, closed |
Superfamily a.65.1: Annexin [47874] (2 families) duplication: consists of four domains of the same fold |
Family a.65.1.1: Annexin [47875] (10 proteins) |
Protein Annexin V [47883] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [47886] (18 PDB entries) |
Domain d1bc1a_: 1bc1 A: [18173] complexed with ca, so4; mutant |
PDB Entry: 1bc1 (more details), 2.05 Å
SCOPe Domain Sequences for d1bc1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bc1a_ a.65.1.1 (A:) Annexin V {Norway rat (Rattus norvegicus) [TaxId: 10116]} alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr dlvndmkselkgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr aikqayeeeygsnleddvvgdtkgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretkgnlenlllavvks irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd tkgdykkallllcggedd
Timeline for d1bc1a_: