PDB entry 1bc1

View 1bc1 on RCSB PDB site
Description: recombinant rat annexin v, quadruple mutant (t72k, s144k, s228k, s303k)
Class: calcium-binding protein
Keywords: calcium binding protein, phospholipid membrane binding protein, calcium-binding protein
Deposited on 1998-05-04, released 1998-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.209
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin v
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14668 (1-318)
      • engineered (71)
      • engineered (143)
      • engineered (227)
      • engineered (302)
    Domains in SCOPe 2.07: d1bc1a_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bc1A (A:)
    malrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfg
    rdlvndmkselkgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeel
    raikqayeeeygsnleddvvgdtkgyyqrmlvvllqanrdpdtaiddaqveldaqalfqa
    gelkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretkgnlenlllavvk
    sirsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikg
    dtkgdykkallllcggedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bc1A (A:)
    alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
    dlvndmkselkgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
    aikqayeeeygsnleddvvgdtkgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
    elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretkgnlenlllavvks
    irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
    tkgdykkallllcggedd