Lineage for d1bc1__ (1bc1 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4582Fold a.65: Annexin [47873] (1 superfamily)
  4. 4583Superfamily a.65.1: Annexin [47874] (1 family) (S)
  5. 4584Family a.65.1.1: Annexin [47875] (7 proteins)
  6. 4604Protein Annexin V [47883] (3 species)
  7. 4623Species Rat (Rattus norvegicus) [TaxId:10116] [47886] (9 PDB entries)
  8. 4628Domain d1bc1__: 1bc1 - [18173]

Details for d1bc1__

PDB Entry: 1bc1 (more details), 2.05 Å

PDB Description: recombinant rat annexin v, quadruple mutant (t72k, s144k, s228k, s303k)

SCOP Domain Sequences for d1bc1__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bc1__ a.65.1.1 (-) Annexin V {Rat (Rattus norvegicus)}
alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkselkgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtkgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretkgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tkgdykkallllcggedd

SCOP Domain Coordinates for d1bc1__:

Click to download the PDB-style file with coordinates for d1bc1__.
(The format of our PDB-style files is described here.)

Timeline for d1bc1__: