| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.88: SRF-like [55454] (1 superfamily) alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet |
Superfamily d.88.1: SRF-like [55455] (1 family) ![]() |
| Family d.88.1.1: SRF-like [55456] (5 proteins) |
| Protein automated matches [191130] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189221] (3 PDB entries) |
| Domain d3mu6d_: 3mu6 D: [181558] automated match to d1egwa_ protein/DNA complex; complexed with bxl |
PDB Entry: 3mu6 (more details), 2.43 Å
SCOPe Domain Sequences for d3mu6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mu6d_ d.88.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkytay
Timeline for d3mu6d_: