Lineage for d3mu6d_ (3mu6 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569729Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 2569730Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 2569731Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 2569768Protein automated matches [191130] (2 species)
    not a true protein
  7. 2569769Species Human (Homo sapiens) [TaxId:9606] [189221] (3 PDB entries)
  8. 2569774Domain d3mu6d_: 3mu6 D: [181558]
    automated match to d1egwa_
    protein/DNA complex; complexed with bxl

Details for d3mu6d_

PDB Entry: 3mu6 (more details), 2.43 Å

PDB Description: inhibiting the binding of class iia histone deacetylases to myocyte enhancer factor-2 by small molecules
PDB Compounds: (D:) myocyte-specific enhancer factor 2a

SCOPe Domain Sequences for d3mu6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mu6d_ d.88.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkytay

SCOPe Domain Coordinates for d3mu6d_:

Click to download the PDB-style file with coordinates for d3mu6d_.
(The format of our PDB-style files is described here.)

Timeline for d3mu6d_: