PDB entry 3mu6
View 3mu6 on RCSB PDB site
Description: Inhibiting the Binding of Class IIa Histone Deacetylases to Myocyte Enhancer Factor-2 by Small Molecules
Class: DNA binding protein/DNA
Keywords: MADS-box/MEF2 domain, transcription co-factors, protein-DNA complex, protein-protein docking, DNA BINDING PROTEIN-DNA complex
Deposited on
2010-05-01, released
2011-11-02
The last revision prior to the SCOPe 2.06 freeze date was dated
2012-07-25, with a file datestamp of
2012-07-20.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.231
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: myocyte-specific enhancer factor 2a
Species: Homo sapiens [TaxId:9606]
Gene: MEF2A, MEF2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3mu6a_ - Chain 'B':
Compound: myocyte-specific enhancer factor 2a
Species: Homo sapiens [TaxId:9606]
Gene: MEF2A, MEF2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3mu6b_ - Chain 'C':
Compound: myocyte-specific enhancer factor 2a
Species: Homo sapiens [TaxId:9606]
Gene: MEF2A, MEF2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3mu6c_ - Chain 'D':
Compound: myocyte-specific enhancer factor 2a
Species: Homo sapiens [TaxId:9606]
Gene: MEF2A, MEF2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3mu6d_ - Chain 'E':
Compound: DNA (5'-d(*ap*ap*ap*gp*cp*tp*ap*tp*tp*ap*tp*tp*ap*gp*cp*tp*t)-3')
- Chain 'F':
Compound: DNA (5'-d(*tp*ap*ap*gp*cp*tp*ap*ap*tp*ap*ap*tp*ap*gp*cp*tp*t)-3')
- Chain 'G':
Compound: DNA (5'-d(*ap*ap*ap*gp*cp*tp*ap*tp*tp*ap*tp*tp*ap*gp*cp*tp*t)-3')
- Chain 'H':
Compound: DNA (5'-d(*tp*ap*ap*gp*cp*tp*ap*ap*tp*ap*ap*tp*ap*gp*cp*tp*t)-3')
- Heterogens: BXL
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3mu6A (A:)
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkytay
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3mu6B (B:)
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkytay
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3mu6C (C:)
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkytay
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>3mu6D (D:)
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkytay
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.